Isolation and amino-acid sequence of two inhibitors of serine proteinase, members of the squash inhibitor family, from Echinocystis lobata seeds

• Autorzy: Stachowiak D. , Polanowski A. , Bieniarz G. , Wilusz T.
• Języki publikacji: EN

Abstrakty

EN

Two serine proteinase inhibitors (ELTII and ELT1II) have been isolated from mature seeds of Echinocystis lobata by ammonium sulfate fractionation, methanol preci­pitation, ion exchange chromatography, affinity chromatography on immobilized anhydrotrypsin and HPLC. ELTI I and ELTI II consist of 33 and 29 amino-acid residues, respectively. The primary structures of these inhibitors are as follows: ELTI I KEEQRVCPRILMRCKRDSDCLAQCTCQQSGFCG ELTI II RVCPRILMRCKRDSDCLAQCTCQQSGFCG The inhibitors show sequence similarity with the squash inhibitor family. ELTI I differs from ELTI II only by the presence of the NH2-terminal tetrapeptide Lys- -Glu-Glu-Gln. The association constants (Ka) of F.LTI I and ELTI II with bovine-trypsin were determined to be 6.6 x 1010 M -1 and 3.1 x 1011 M -1, whereas the association constants of these inhibitors with cathepsin G were 1.2 x 107 M -1 and 1.1 x 107 M -1, respectively.

Słowa kluczowe

EN

serine proteinase; Cucurbitaceae; Echinocystis lobata; trypsin inhibitor; amino acid sequence; squash inhibitor; inhibitor; seed; cathepsin G

• Wydawca: -
• Czasopismo: Acta Biochimica Polonica
• Rocznik: 1996
• Tom: 43
• Numer: 3
• Opis fizyczny: p.507-513,fig.

Twórcy

autor

Stachowiak D.

• University of Wroclaw, Tamka 2, 50-137 Wroclaw, Poland

autor

Polanowski A.

autor

Bieniarz G.

autor

Wilusz T.

Bibliografia

• 1. Polanowski, A., Wilusz, T., Nienartowicz, B., Cie^Iar, E., Slomiriska, E. & Nowak, K. (1980) Isolation and partial amino acid sequence of the trypsin inhibitor from the seeds of Cucurbita maxima. Acta Biochim. Polon. 27,371-382.
• 2. Wieczorek, M., Otlewski, J., Cook, J., Parks, K., Leluk, J., Wilimowska-Pelc, A., Polanowski, A., Wilusz, T. & Laskowski, M., Jr. (1985) The squash family of serine proteinase inhibitors. Amino acid sequences and association equilibrium constants of inhibitors from squash, summer squash, zucchini, and cucumber seeds. Biochem. Biophys. Res. Commun. 126, 646-652.
• 3. Otlewski, J., Whatley, H., Polanowski, A. & Wilusz, T. (1987) Amino-acid sequences of trypsin inhibitors from watermelon (Citrulus vulgaris) and red bryony (Bryonia dioica) seeds. Biol. Chem. lioppe-Seyler 368,1505-1507.
• 4. Joubert, F.J. (1984) Trypsin isoinhibitors from Momordica repens seeds. Phytochemistry 23, 1401-1406.
• 5. Heitz, A., Chiche, L., Le-Nguyen, D. & Castro, B. (1989) 'h 2D NMK and distance geometry study of the folding of Ecballium elaterium trypsin inhibitor, a member of the squash inhibitors family. Biochemistry 28,2392-2398.
• 6. Nishino, J., Takano, R., Kamei-Hayashi, K., Minakata, H., Nomoto, K. & Hara, S. (1992) Amino acid sequences of trypsin inhibitors from oriental pickling melon (Cucumis melo L. var. Common Makino) seeds. Biosci. Biotech. Biochem. 56, 1241-1246.
• 7. I.ee, Ch.-F. & Lin, J.-Y. (1995) Amino acid sequences of trypsin inhibitors from the melon Cucumis melo. /. Biochem. 118,18-22.
• 8. Hatakeyama, T., Hiraoka, M. & Funatsu, G., (1991) Amino acid sequences of the two smallest trypsin inhibitors from sponge gourd seeds. Agric. Biol. Chem. 55,2641-2642.
• 9. Ling, M.-H., Qi, H.-Y. & Chi, Ch.-W. (1993) Protein, cDNA, and genomic DN A sequences of the towel gourd trypsin inhibitor, a squash family inhibitor. J. Biol. Chem. 268,810-814.
• 10. Matsuo, M., Hamato, N., Takano, R., Kamei- -Hayashi, K., Yasuda-Kamatani, Y., Nomoto, K. & Hara, S. (1992) Trypsin inhibitors from bottle gourd (Lagenaria leucantha Rusby var. Depressa Makino) seeds. Purification and amino acid sequences. Biochim. Biophys. Acta 1120,187-192.
• 11. Hayashi, K., Takehisa, T., Hamato, N., Takano, R., Hara, S., Miyata, T. & Kato, H. (1994) Inhibition of serine proteinases of the blood coagulation system by squash family proteinase inhibitors. J. Biochem. (Tokyo) 116,1013-1018.
• 12. 1 lama to, N., Koshiba, T., Pham, T.-N., Tatsumi, Y., Nakamura, D., Takano, R., Hayashi, K., Hong, Y.-M. & Hara, S. (1995) Trypsin and elastase inhibitors from bitter gourd (Momordica charantia Linn.) seeds. Purification, amino acid sequences, and inhibitory activity of four new inhibitors. J. Biochem. (Tokyo) 117, 432-437.
• 13. Haldar, U.C., Saha, S.K., Beavis, R.C. & Sinha, N.K. (1996) Trypsin inhibitors from ridged gourd (Luffa acutangula Linn) seeds: Purifi­cation, properties, and amino acid sequences. J. Protein Chem. 15,177-184.
• 14. Huang, Q., Liu, H. & Tang, Y. (1993) Refined 1.6 A resolution crystal structure of the complex formed between porcine (J-trypsin and CMTI-A, a trypsin inhibitor of the squash family. Detailed comparison with bovine P-trypsin and its complex. /. Mol. Biol. 229,1022-1036.
• 15. Bode, W., Greyling, H.J., Huber, R.,Otlewski, J. & Wilusz, T. (1989) The refined 2.0 A X-ray crys­tal structure of the complex formed between bovine ^-trypsin and CMTI-I, a trypsin inhibitor from squash seeds (Cucurbita maxima). Topo­logical similarity of the squash seed inhibitors with the carboxypeptidase A inhibitor from potatoes. FEBS Lett. 242,285-292.
• 16. Likos, J.J. (1989) 'H-n.m.r. studies of squash seed trypsin inhibitor. Int. J. Peptide Protein Res. 43, 381-386.
• 17. Holak, T.A., Gondol, D., Otlewski, J. & Wilusz, T. (1989) Determination of the complete three-dimensional structure of the trypsin inhibitor from squash seeds in aqueous solution by nuclear magnetic resonance and a combi­nation of distance geometry and dynamical simulated annealing. /. Mol. Biol. 210,635-648.
• 18. Krishnamoorthi, R. & Sun Lin Ch.-L. (1992) Structural consequences of the natural substi­tution, K9K, on reactive-site-hydrolyzed squash (Cucurbita maxima) trypsin inhibitor (CMTI) as studied by two-dimensional NMR. Biochemistry 31,4965-4969.
• 19. Chen, X.-M., Qian, Y.-W., Chi, Ch.-W., Gan, K.-D., Zhang, M.-F. & Chen, Ch.-Q. (1992) Chemical synthesis, molecular cloning and expression of the gene coding for the 7ft- chosanthes trypsin inhibitor — a squash family inhibitor. J. Biochem. (Tokyo) 112,45-51.
• 20. Rolka, K., Kuprys2ewski, G., Ragnarsson, U., Otlewski, J., Krokoszynska, I. & Wilusz, T. (1991) Chemical synthesis of new trypsin, chymo- trypsin and elastase inhibitors by amino-acid substitution in a trypsin inhibitor from squash seeds (CMTI III) Biol. Chem. Hoppe-Scyler 372, 63-68.
• 21. Bolewska, K., Krowarsch, D., Otlewski, J., Jaro- szewski, L. & Bierzynski, A. (1995) Synthesis, cloning and expression in Escherichia coli of a gene coding for the Met8^Leu CMTI I — a representative of the squash inhibitors of serine proteinases. FEBS Lett. 377,172-174.
• 22. Rempola, B., Wilusz, T., Markiewicz, W. & Fikus, M. (1995) Synthesis, cloning and expre­ssion in Escherichia coli of the gene coding for the trypsin inhibitor from Cucurbita pepo. Acta Biochim. Polon. 42,109-114.
• 23. Wilimowska-Pelc, A. & Mejbaum-Katzenellen- bogen, W. (1978) A simple method for isolating trypsin from trichloroacetic acid extracts of bovine pancreas. Anal. Biochem. 90,816-820.
• 24. Iiepniecks, J.J. & Light, A. (1974) Preparation of p-trypsin by affinity chromatography of entero- kinase-activated bovine trypsinogen. Anal. Biochem. 60,395-404.
• 25. Ako, H., Foster, R.J. & Ryan, C.A. (1972) The preparation of anhydro-trypsin and its reacti­vity with naturally occurring proteinase inhi­bitors. Biochem. Biophys. Res. Commun. 47,1402- -1407.26. Chase, T. & Shaw, E. (1970) Titration of trypsin, plasmin and thrombin with p-nitrophenyl p'-guanidinobenzoate HC1. Methods Enzymol. 19,20-27.
• 27. Erlanger, B.F., Kokowsky, N. & Cohen, W. (1961) The preparation and properties of two new chromogenic substrates of trypsin. Arch. Bio- chetn. Biophys. 95,271-278.
• 28. Wtorek, W., Polanowski, A. & Wilusz, T. (1996) Tne use of sequencial affinity chromatography for separation of human neutrophil elastase, cathepsinG and azurocidin. Acta Biochim. Polon. 43,503-506.
• 29. Empie, M. & Laskowski, M., Jr. (1982) Thermodynamics and kinetics of single residue replacements in avian ovomucoid third do­mains: effect on inhibitor interactions with serine proteinases. Biochemistry 21,2274-2284.
• 30. Otlewski, J., Zbyryt, T., Krokoszyriska, 1. & Wilusz, T. (1990) Inhibition of serine proteinases by squash inhibitors. Biol. Chem. Hoppe-Seyler 371, 589-594.
• 31. Pepper, D.S. (1992) Some alternative coupling chemistries for affinity chromatography; in Practical Protein Chromatography (Kenney, A. & Howell, $., eds.) pp. 181-183, The I Iumana Press, Totowa, New Jersey.
• 32. Cohen, S.A. & Michaud, D.P. (1993) Synthesis of a fluorescent derivatizing reagent, 6-amino- quinolyl-N-hydroxysuccinimidyl carbamate and its application for the analysis of hydro- lysate amino acids via high-performance liquid chromatography. Anal. Biochem. 211,279-287.